PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G194600.1
Common NamePHAVU_002G194600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 180aa    MW: 20965.9 Da    PI: 9.8162
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G194600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.42.4e-151563149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        k+ien++   +tf+kR+  i KKA+ELS+LC+a+v +++  s+g+ + y
  Phvul.002G194600.1 15 KKIENNRDLLITFTKRKRDIHKKASELSTLCGAKVDILMHTSSGNWFSY 63
                        689***************************************9987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.881767IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-14766IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-18987IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-12929IPR002100Transcription factor, MADS-box
PfamPF003196.7E-151663IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-122944IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-124465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEGKMIKQKK KREIKKIENN RDLLITFTKR KRDIHKKASE LSTLCGAKVD ILMHTSSGNW  60
FSYGEPSRQA MTVSKDKQNP SEDVINQLVE NQTKVEIDEL CAKNKTLTDQ MHYEEEREKE  120
LTEILKTRNA HGWWEAKDLN REQAKEMRAS LMELKQKLEN ELSIKRGEKD RSSHHGKQG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1931KKREIKKIENNRDLLITFTKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158940.11e-129hypothetical protein PHAVU_002G194600g
TrEMBLV7CLB01e-129V7CLB0_PHAVU; Uncharacterized protein
STRINGGLYMA08G08870.11e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1822966
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28460.16e-14AGAMOUS-like 59